Structure of PDB 4yuu Chain b2

Receptor sequence

>4yuub2 (length=481) Species: 2771 (Cyanidium caldarium) [Search protein sequence]

ALPWYRVHTVVLNDPGRLISVHLMHTALVSGWAGSMALYELAVFDPSDPV
LNPMWRQGMFVMPFMARLGVTDSWGGWSITGESVSNPGLWSFEGVALTHI
VLSGLLFLASIWHWVYWDLDLFRDPRTLEPALDLPKVFGIHLVLSSLLCF
GFGAFHVTGLFGPGIWISDAYGLTGRIQSVAPAWGPEGFNPFNPGGIASH
HIAAGTVGILAGVFHLNVRPPQRLYRALRMGNIETVLSSSIAAVFFASFV
VSGTMWYGAASTPIELFGPTRYQWDSGYFQQEIEKRVEESLSNGLSLPEA
WSNIPDKLAFYDYIGNNPAKGGLFRAGPMNKGDGIAEAWLGHPVFQDKEG
HELIVRRMPAFFENFPIILVDKDGIIRADIPFRRAESKYSIEQVGVTCSF
YGGKLNNQSFKDASTVKKYARKAQFGEVFEFDRTILDSDGVFRSSPRGWF
TFGHANFALLFFFGHLWHGSRTLFRDVFAGI

3D structure

PDB

4yuu Novel Features of Eukaryotic Photosystem II Revealed by Its Crystal Structure Analysis from a Red Alga

Chain

Resolution

2.77 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	b2	W185 G186 P187	W184 G185 P186
BS02	CLA	b2	R68 L69 L149 C150 F153 H201 H202 F247 A248 V252	R67 L68 L148 C149 F152 H200 H201 F246 A247 V251
BS03	CLA	b2	T27 V30 S31 V62 F65 M66 H100	T26 V29 S30 V61 F64 M65 H99
BS04	CLA	b2	V71 W91 T99 H100 V102 L103 L149 G152 F153 H157 F162 P164	V70 W90 T98 H99 V101 L102 L148 G151 F152 H156 F161 P163
BS05	CLA	b2	F139 A212 F215 H216 P221 P222 L229	F138 A211 F214 H215 P220 P221 L228
BS06	CLA	b2	F139 H142 S146 M231 V237 S240	F138 H141 S145 M230 V236 S239
BS07	CLA	b2	Y6 R7 V8 H9 I242 F462 G465 W468 H469 R472	Y5 R6 V7 H8 I241 F461 G464 W467 H468 R471
BS08	CLA	b2	H201 A204 A205 F247 F250	H200 A203 A204 F246 F249
BS09	CLA	b2	H9 L19 V22 H23 H26 I234 V237 L238 S241	H8 L18 V21 H22 H25 I233 V236 L237 S240
BS10	CLA	b2	H9 H26 V30 W33 F462	H8 H25 V29 W32 F461
BS11	CLA	b2	W33 F61 F65 A248 S249 V252 F451 H455 F458 F462	W32 F60 F64 A247 S248 V251 F450 H454 F457 F461
BS12	CLA	b2	V8 H9 V22	V7 H8 V21
BS13	CLA	b2	I20 H23 V138 I141 H142 L145	I19 H22 V137 I140 H141 L144
BS14	CLA	b2	I20 L24 W113 H114 L120	I19 L23 W112 H113 L119
BS15	CLA	b2	W33 M37 Y40 G59 F61 A327 G328 W450	W32 M36 Y39 G58 F60 A326 G327 W449
BS16	CLA	b2	A243 F463 H466 L467 L474	A242 F462 H465 L466 L473

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity

	Biological Process
GO:0009767	photosynthetic electron transport chain
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009521	photosystem
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4yuu, PDBe:4yuu, PDBj:4yuu
PDBsum	4yuu
PubMed	26757821
UniProt	O19928\|PSBB_CYACA Photosystem II CP47 reaction center protein (Gene Name=psbB)

[Back to BioLiP]