Structure of PDB 7vor Chain b1

Receptor sequence
>7vorb1 (length=47) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
WMIFDPRRVFVAQGVFLFLLAVMIHLILLSTPSYNWLEISAAKYNRV
3D structure
PDB7vor Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
Chainb1
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SPO b1 V29 H32 V22 H25
BS02 BCL b1 H32 W43 H25 W36
BS03 BCL b1 I31 Y41 I24 Y34
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vor, PDBe:7vor, PDBj:7vor
PDBsum7vor
PubMed35418573
UniProtQ3J1A4|LHA1_CERS4 Light-harvesting protein B-875 alpha chain (Gene Name=pufA)

[Back to BioLiP]