Structure of PDB 6hcm Chain b1

Receptor sequence
>6hcmb1 (length=101) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R
3D structure
PDB6hcm ZNF598 Is a Quality Control Sensor of Collided Ribosomes.
Chainb1
Resolution6.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b1 T2 K4 R5 R6 N8 R10 K12 R15 K32 K34 K37 F39 K82 V84 R85 R87 S88 R89 R92 R95 P98 T1 K3 R4 R5 N7 R9 K11 R14 K31 K33 K36 F38 K81 V83 R84 R86 S87 R88 R91 R94 P97
BS02 rna b1 I41 E46 H80 R100 R102 I40 E45 H79 R99 R101
BS03 ZN b1 C26 C77 C25 C76
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 21:04:04 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6hcm', asym_id = 'b1', title = 'ZNF598 Is a Quality Control Sensor of Collided Ribosomes.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6hcm', asym_id='b1', title='ZNF598 Is a Quality Control Sensor of Collided Ribosomes.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6hcm', asym_id = 'b1'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6hcm', asym_id='b1')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>