Structure of PDB 7vot Chain b0

Receptor sequence
>7votb0 (length=43) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
LGYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF
3D structure
PDB7vot Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
Chainb0
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL b0 Y24 F49 Y18 F43
BS02 BCL b0 F31 V34 A35 A38 H39 V42 F25 V28 A29 A32 H33 V36
BS03 SPO b0 E19 L20 V23 G27 L28 F31 E13 L14 V17 G21 L22 F25
BS04 BCL b0 F31 H39 V42 W48 F49 F25 H33 V36 W42 F43
BS05 SPO b0 F31 V34 A38 A41 V42 W45 F25 V28 A32 A35 V36 W39
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vot, PDBe:7vot, PDBj:7vot
PDBsum7vot
PubMed35418573
UniProtQ3J1A3|LHB1_CERS4 Light-harvesting protein B-875 beta chain (Gene Name=pufB)

[Back to BioLiP]