Structure of PDB 7vor Chain b0

Receptor sequence
>7vorb0 (length=44) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
DLGYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF
3D structure
PDB7vor Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
Chainb0
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL b0 Y24 F49 Y19 F44
BS02 BCL b0 F31 A35 A38 H39 F26 A30 A33 H34
BS03 SPO b0 L20 V23 G27 L28 F31 L15 V18 G22 L23 F26
BS04 BCL b0 S32 H39 V42 W48 F49 S27 H34 V37 W43 F44
BS05 SPO b0 A38 A41 W45 A33 A36 W40
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vor, PDBe:7vor, PDBj:7vor
PDBsum7vor
PubMed35418573
UniProtQ3J1A3|LHB1_CERS4 Light-harvesting protein B-875 beta chain (Gene Name=pufB)

[Back to BioLiP]