Structure of PDB 8wy0 Chain b

Receptor sequence

>8wy0b (length=30) Species: 9606 (Homo sapiens)

LDPKLCYLLDGILFIYGVILTALFLRVKFS

3D structure

• PDB: 8wy0 Structures of human gamma delta T cell receptor-CD3 complex.
• Chain: b
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	b	C32 L35 L39 F40 Y42 L46 T47 L49 F50	C6 L9 L13 F14 Y16 L20 T21 L23 F24
BS02	CLR	b	A48 L51 R52 F55	A22 L25 R26 F29

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity

Biological Process

• GO:0007166 cell surface receptor signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:8wy0, PDBe:8wy0, PDBj:8wy0
• PDBsum: 8wy0
• PubMed: 38657677
• UniProt: P20963|CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain (Gene Name=CD247)