Structure of PDB 8rjb Chain b

Receptor sequence

>8rjbb (length=104) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK
KGLKKMQANNAKAMAARAEAIKALVVSRKLHRLAYIAHPKLGRRARARIA
RGLR

3D structure

PDB

8rjb UCSF ChimeraX: Meeting modern challenges in visualization and analysis.

Chain

Resolution

2.69243 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	A2 K3 K5 N6 H7 T8 T9 H10 N11 Q12 S13 K15 H17 R18 N19 K22 R25 S26 Q27 R28 Y29 S31 L32 K33 D36 P37 K38 F39 R41 N42 M43 R44 F45 A46 K47 H49 N50 G53 M57 N61 R68 R91 K92 H101 P102 K103 R106 R111 R114 G115	A1 K2 K4 N5 H6 T7 T8 H9 N10 Q11 S12 K14 H16 R17 N18 K21 R24 S25 Q26 R27 Y28 S30 L31 K32 D35 P36 K37 F38 R40 N41 M42 R43 F44 A45 K46 H48 N49 G52 M56 N60 R67 R78 K79 H88 P89 K90 R93 R98 R101 G102

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8rjb, PDBe:8rjb, PDBj:8rjb
PDBsum	8rjb
PubMed	38896445
UniProt	G1SGR6\|RL29_RABIT Large ribosomal subunit protein eL29 (Gene Name=RPL29)