Structure of PDB 8qsj Chain b

Receptor sequence
>8qsjb (length=149) Species: 9606 (Homo sapiens) [Search protein sequence]
TARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREV
IDFARRNPGVVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLV
QKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTFRGLRPREVQD
3D structure
PDB8qsj Structural insights into the role of GTPBP10 in the RNA maturation of the mitoribosome.
Chainb
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b X2 A3 R4 D36 A38 P69 C70 C71 R74 H90 C91 R114 R116 K117 F119 X1 A2 R3 D35 A37 P68 C69 C70 R73 H89 C90 R113 R115 K116 F118
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qsj, PDBe:8qsj, PDBj:8qsj
PDBsum8qsj
PubMed38042949
UniProtQ8N983|RM43_HUMAN Large ribosomal subunit protein mL43 (Gene Name=MRPL43)

[Back to BioLiP]