Structure of PDB 8qfd Chain b

Receptor sequence

>8qfdb (length=65) Species: 9606 (Homo sapiens)

AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK
KGLKKMQANNAKAMS

3D structure

• PDB: 8qfd The UFM1 E3 ligase recognizes and releases 60S ribosomes from ER translocons
• Chain: b
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	A2 K3 S4 K5 N6 H7 T8 T9 H10 N11 Q12 S13 R14 K15 H17 R18 N19 K23 S26 Q27 R28 Y29 S31 L32 K33 D36 P37 K38 N42 R44 F45 A46 K47 K48 H49 N50 K52 K56 M57 N60 N61	A1 K2 S3 K4 N5 H6 T7 T8 H9 N10 Q11 S12 R13 K14 H16 R17 N18 K22 S25 Q26 R27 Y28 S30 L31 K32 D35 P36 K37 N41 R43 F44 A45 K46 K47 H48 N49 K51 K55 M56 N59 N60

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008201 heparin binding
• GO:0045296 cadherin binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0007566 embryo implantation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qfd, PDBe:8qfd, PDBj:8qfd
• PDBsum: 8qfd
• PubMed: 38383789
• UniProt: P47914|RL29_HUMAN Large ribosomal subunit protein eL29 (Gene Name=RPL29)