Structure of PDB 8q7q Chain b

Receptor sequence

>8q7qb (length=73) Species: 9606 (Homo sapiens) [Search protein sequence]

SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKREEKR
VLGLVLLRGENLVSMTVEGPPPK

3D structure

PDB

8q7q Structural basis of human U5 snRNP late biogenesis and recycling.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	H37 K50	H32 K45

Gene Ontology

	Biological Process
GO:0000387	spliceosomal snRNP assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0006479	protein methylation
GO:0008380	RNA splicing
GO:0036261	7-methylguanosine cap hypermethylation
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005683	U7 snRNP
GO:0005684	U2-type spliceosomal complex
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005687	U4 snRNP
GO:0005689	U12-type spliceosomal complex
GO:0005697	telomerase holoenzyme complex
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0030532	small nuclear ribonucleoprotein complex
GO:0034709	methylosome
GO:0034719	SMN-Sm protein complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071004	U2-type prespliceosome
GO:0071005	U2-type precatalytic spliceosome
GO:0071007	U2-type catalytic step 2 spliceosome
GO:0071013	catalytic step 2 spliceosome
GO:0071204	histone pre-mRNA 3'end processing complex

External links

PDB	RCSB:8q7q, PDBe:8q7q, PDBj:8q7q
PDBsum	8q7q
PubMed	38467876
UniProt	P14678\|RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B' (Gene Name=SNRPB)