Structure of PDB 8fn2 Chain b

Receptor sequence

>8fn2b (length=100) Species: 224326 (Borreliella burgdorferi B31)

IKRKLRLQLKKARFNASRSRSKNKCFIKRMENNRKIISKNNINVQVFLVR
SLIGKLNKKVKVLKALGLNKIGDKKVHFLNESIKGMLNETINMILLSEVM

3D structure

• PDB: 8fn2 The structure of a hibernating ribosome in a Lyme disease pathogen.
• Chain: b
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	I2 K3 R4 K5 R7 L10 K11 K12 F15 S18 R19 K23 K25 R51 S52 I54 G55 K56 N58 V63 A66 I72 H78 S83 M87	I1 K2 R3 K4 R6 L9 K10 K11 F14 S17 R18 K22 K24 R50 S51 I53 G54 K55 N57 V62 A65 I71 H77 S82 M86
BS02	rna	b	R19 N24 F27 I28 R35 R51 K60 N93	R18 N23 F26 I27 R34 R50 K59 N92

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fn2, PDBe:8fn2, PDBj:8fn2
• PDBsum: 8fn2
• PubMed: 37907464
• UniProt: A0A0H3C073