Structure of PDB 8cmj Chain b

Receptor sequence
>8cmjb (length=91) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGA
AGIWTCSCCKKTVAGGAYTVSTAAAATVRSTIRRLREMVEA
3D structure
PDB8cmj Cryo-EM analysis of eukaryotic ribosome translocation intermediates
Chainb
Resolution3.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b A2 K3 R4 T5 K6 V8 G9 I10 K13 V16 R17 Y18 G19 S21 L22 R23 H34 F41 C42 R49 A51 Y69 A1 K2 R3 T4 K5 V7 G8 I9 K12 V15 R16 Y17 G18 S20 L21 R22 H33 F40 C41 R48 A50 Y68
BS02 rna b Q25 R85 Q24 R84
BS03 ZN b C39 C42 C57 C38 C41 C56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cmj, PDBe:8cmj, PDBj:8cmj
PDBsum8cmj
PubMed38030725
UniProtP0CX25|RL43A_YEAST Large ribosomal subunit protein eL43A (Gene Name=RPL43A)

[Back to BioLiP]