Structure of PDB 8cku Chain b

Receptor sequence

>8ckub (length=91) Species: 4932 (Saccharomyces cerevisiae)

AKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGA
AGIWTCSCCKKTVAGGAYTVSTAAAATVRSTIRRLREMVEA

3D structure

• PDB: 8cku mRNA reading frame maintenance during eukaryotic ribosome translocation
• Chain: b
• Resolution: 3.11 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	A2 R4 T5 K6 K7 V8 G9 I10 G12 K13 Y14 G15 V16 R17 Y18 G19 S20 S21 R23 E30 Q33 H34 R36 F41 C42 R49 A51 Y69	A1 R3 T4 K5 K6 V7 G8 I9 G11 K12 Y13 G14 V15 R16 Y17 G18 S19 S20 R22 E29 Q32 H33 R35 F40 C41 R48 A50 Y68
BS02	rna	b	Q25 R84 R85	Q24 R83 R84
BS03	ZN	b	C39 C42 C57	C38 C41 C56

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0046872 metal ion binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cku, PDBe:8cku, PDBj:8cku
• PDBsum: 8cku
• PubMed: 38030725
• UniProt: P0CX25|RL43A_YEAST Large ribosomal subunit protein eL43A (Gene Name=RPL43A)