Structure of PDB 7zdj Chain b |
>7zdjb (length=95) Species: 9940 (Ovis aries) [Search protein sequence] |
GVRTSPTGEKVTHTGQVYDDEDYRRVRFVGRQKEVNENFAIDLIAEQPVS QVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQQH |
|
PDB | 7zdj A universal coupling mechanism of respiratory complex I. |
Chain | b |
Resolution | 3.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
b |
C59 H68 C84 C87 |
C59 H68 C84 C87 |
|
|
|
|