Structure of PDB 7tm3 Chain b

Receptor sequence

>7tm3b (length=104) Species: 9986 (Oryctolagus cuniculus)

AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK
KGLKKMQANNAKAMAARAEAIKALVVSRKLHRLAYIAHPKLGRRARARIA
RGLR

3D structure

• PDB: 7tm3 Mechanism of an intramembrane chaperone for multipass membrane proteins.
• Chain: b
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	K3 S4 K5 N6 H7 T8 T9 H10 N11 Q12 S13 R14 K15 H17 R18 N19 K22 R25 S26 Q27 R28 Y29 S31 L32 K33 P37 K38 F39 N42 M43 R44 F45 A46 K47 H49 N50 G53 M57 N60 N61 R68 R91 K92 P102 R106 R111 R114 G115 R117	K2 S3 K4 N5 H6 T7 T8 H9 N10 Q11 S12 R13 K14 H16 R17 N18 K21 R24 S25 Q26 R27 Y28 S30 L31 K32 P36 K37 F38 N41 M42 R43 F44 A45 K46 H48 N49 G52 M56 N59 N60 R67 R78 K79 P89 R93 R98 R101 G102 R104

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7tm3, PDBe:7tm3, PDBj:7tm3
• PDBsum: 7tm3
• PubMed: 36261528
• UniProt: G1SGR6|RL29_RABIT Large ribosomal subunit protein eL29 (Gene Name=RPL29)