Structure of PDB 7syu Chain b

Receptor sequence

>7syub (length=101) Species: 9986 (Oryctolagus cuniculus)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

• PDB: 7syu Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.
• Chain: b
• Resolution: 4.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	T2 K3 K4 R5 R6 N7 N8 G9 R10 A11 K13 G14 R15 H17 P20 K34 I36 K37 K38 F39 K70 V75 I79 H80 K82 R85 R87 S88 R89 R92 R95 P98	T1 K2 K3 R4 R5 N6 N7 G8 R9 A10 K12 G13 R14 H16 P19 K33 I35 K36 K37 F38 K69 V74 I78 H79 K81 R84 R86 S87 R88 R91 R94 P97
BS02	rna	b	H80 S81 R102	H79 S80 R101
BS03	ZN	b	C23 C26	C22 C25

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:7syu, PDBe:7syu, PDBj:7syu
• PDBsum: 7syu
• PubMed: 35822879
• UniProt: G1TFE8|RS26_RABIT Small ribosomal subunit protein eS26 (Gene Name=RPS26)