Structure of PDB 7sys Chain b

Receptor sequence

>7sysb (length=101) Species: 9986 (Oryctolagus cuniculus)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

• PDB: 7sys Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.
• Chain: b
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	T2 K3 K4 R5 R6 N7 N8 R10 K13 G14 R15 H17 R28 K32 K34 K37 F39 V75 I79 H80 K82 V84 R87 S88 R92 K93 R95 P98	T1 K2 K3 R4 R5 N6 N7 R9 K12 G13 R14 H16 R27 K31 K33 K36 F38 V74 I78 H79 K81 V83 R86 S87 R91 K92 R94 P97
BS02	rna	b	E46 H80 S81 R102	E45 H79 S80 R101
BS03	ZN	b	C23 C26 C74 C77	C22 C25 C73 C76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:7sys, PDBe:7sys, PDBj:7sys
• PDBsum: 7sys
• PubMed: 35822879
• UniProt: G1TFE8|RS26_RABIT Small ribosomal subunit protein eS26 (Gene Name=RPS26)