Structure of PDB 7sym Chain b

Receptor sequence

>7symb (length=101) Species: 9986 (Oryctolagus cuniculus)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

• PDB: 7sym Comprehensive structural overview of the HCV IRES-mediated translation initiation pathway
• Chain: b
• Resolution: 4.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	T2 K3 K4 R5 R6 N7 N8 R10 A11 K12 K13 G14 R15 H17 R28 K32 K37 K38 F39 Y68 K70 V75 I79 H80 K82 R87 S88 R92 K93 R95 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 R9 A10 K11 K12 G13 R14 H16 R27 K31 K36 K37 F38 Y67 K69 V74 I78 H79 K81 R86 S87 R91 K92 R94 P96 P97 R99
BS02	ZN	b	C23 C26 C77	C22 C25 C76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:7sym, PDBe:7sym, PDBj:7sym
• PDBsum: 7sym
• UniProt: G1TFE8|RS26_RABIT Small ribosomal subunit protein eS26 (Gene Name=RPS26)