Structure of PDB 7syk Chain b

Receptor sequence

>7sykb (length=101) Species: 9986 (Oryctolagus cuniculus)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

• PDB: 7syk Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.
• Chain: b
• Resolution: 4.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	T2 K3 K4 R5 R6 N7 N8 R10 A11 K13 G14 R15 H17 R28 K32 K34 I36 K38 F39 Y68 V75 I79 H80 K82 V84 R87 S88 R92 R95 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 R9 A10 K12 G13 R14 H16 R27 K31 K33 I35 K37 F38 Y67 V74 I78 H79 K81 V83 R86 S87 R91 R94 P96 P97 R99
BS02	ZN	b	C23 C74 C77	C22 C73 C76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:7syk, PDBe:7syk, PDBj:7syk
• PDBsum: 7syk
• PubMed: 35822879
• UniProt: G1TFE8|RS26_RABIT Small ribosomal subunit protein eS26 (Gene Name=RPS26)