Structure of PDB 7sgf Chain b

Receptor sequence

>7sgfb (length=140)

GGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFNKQAIQR
LKAPAQMSIQLINKAVNALINDQLIMKNHLRDIMCIPYCNYSKYWYLNHT
TTGRTSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEML

3D structure

• PDB: 7sgf Lassa virus glycoprotein nanoparticles elicit neutralizing antibody responses and protection.
• Chain: b
• Resolution: 4.41 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BMA	b	R282 W283	R7 W8

Gene Ontology

Molecular Function

• GO:0016829 lyase activity

Cellular Component

• GO:0019031 viral envelope

External links

• PDB: RCSB:7sgf, PDBe:7sgf, PDBj:7sgf
• PDBsum: 7sgf
• PubMed: 36400021
• UniProt: P08669|GLYC_LASSJ Pre-glycoprotein polyprotein GP complex (Gene Name=GPC)