Structure of PDB 7ope Chain b

Receptor sequence
>7opeb (length=58) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
RKCVITGKKTTAGNNRSHAMNASKRTWGANLQKVRILVNGKPKKVYVSAR
ALKSGKVE
3D structure
PDB7ope RqcH and RqcP catalyze processive poly-alanine synthesis in a reconstituted ribosome-associated quality control system.
Chainb
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b R3 K10 T12 T13 A14 N16 R18 S19 H20 A21 M22 N23 K26 R27 W29 G30 A31 N32 Q34 K35 R37 Y48 R52 K55 S56 R1 K8 T10 T11 A12 N14 R16 S17 H18 A19 M20 N21 K24 R25 W27 G28 A29 N30 Q32 K33 R35 Y46 R50 K53 S54
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ope, PDBe:7ope, PDBj:7ope
PDBsum7ope
PubMed34255840
UniProtP37807|RL28_BACSU Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]