Structure of PDB 7opd Chain b

Receptor sequence
>7opdb (length=520) Species: 9606 (Homo sapiens) [Search protein sequence]
DAEFDEGFKVPGFLFKKLFKYQQTGVRWLWELHCQQAGGILGDEMGLGRT
IQIIAFLAGLSYSKIRRFEGLGPTVIVCPTTVMHQWVKEFHTWWPPFRVA
ILHETGSYTHKKEKLIRDVAHCHGILITSYSYIRLMQDDISRYDWHYVIL
DEGHKIRNPNAAVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFIFPG
KLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRR
MKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFVDSKEVYRILNGEMQI
FSGLIALRKICNHPDLFSGEEDQFGYWKRSGKMIVVESLLKIWHKQGQRV
LLFSQSRQMLDILEVFLRAQKYTYLKMDGTTTIASRQPLITRYNEDTSIF
VFLLTTRVGGLGVNLTGANRVVIYDPDWNPSTDTQARERAWRIGQKKQVT
VYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKSNDLYELFTLT
SPDPLASSSLLAKMRARNHL
3D structure
PDB7opd Structural basis of human transcription-DNA repair coupling.
Chainb
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna b R629 R652 N653 A656 A657 V658 F796 W936 K979 R134 R157 N158 A161 A162 V163 F301 W428 K471
BS02 dna b H598 S626 Y627 E792 F796 S797 I800 K804 S864 R865 G887 R894 T913 R915 H103 S131 Y132 E297 F301 S302 I305 K309 S356 R357 G379 R386 T405 R407
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003682 chromatin binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0030296 protein tyrosine kinase activator activity
GO:0140658 ATP-dependent chromatin remodeler activity
Biological Process
GO:0000012 single strand break repair
GO:0000077 DNA damage checkpoint signaling
GO:0000303 response to superoxide
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006284 base-excision repair
GO:0006290 pyrimidine dimer repair
GO:0006338 chromatin remodeling
GO:0006362 transcription elongation by RNA polymerase I
GO:0006366 transcription by RNA polymerase II
GO:0006974 DNA damage response
GO:0006979 response to oxidative stress
GO:0007254 JNK cascade
GO:0007399 nervous system development
GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009411 response to UV
GO:0009636 response to toxic substance
GO:0010165 response to X-ray
GO:0010224 response to UV-B
GO:0010332 response to gamma radiation
GO:0022008 neurogenesis
GO:0030182 neuron differentiation
GO:0031175 neuron projection development
GO:0032784 regulation of DNA-templated transcription elongation
GO:0032786 positive regulation of DNA-templated transcription, elongation
GO:0034243 regulation of transcription elongation by RNA polymerase II
GO:0035264 multicellular organism growth
GO:0042262 DNA protection
GO:0045494 photoreceptor cell maintenance
GO:0045739 positive regulation of DNA repair
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0045945 positive regulation of transcription by RNA polymerase III
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
GO:0097680 double-strand break repair via classical nonhomologous end joining
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2001033 negative regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0008023 transcription elongation factor complex
GO:0090734 site of DNA damage
GO:0110016 B-WICH complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7opd, PDBe:7opd, PDBj:7opd
PDBsum7opd
PubMed34526721
UniProtQ03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 (Gene Name=ERCC6)

[Back to BioLiP]