Structure of PDB 7oob Chain b

Receptor sequence
>7oobb (length=520) Species: 9606 (Homo sapiens) [Search protein sequence]
DAEFDEGFKVPGFLFKKLFKYQQTGVRWLWELHCQQAGGILGDEMGLGKT
IQIIAFLAGLSYSKIRRFEGLGPTVIVCPTTVMHQWVKEFHTWWPPFRVA
ILHETGSYTHKKEKLIRDVAHCHGILITSYSYIRLMQDDISRYDWHYVIL
DEGHKIRNPNAAVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFIFPG
KLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRR
MKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFVDSKEVYRILNGEMQI
FSGLIALRKICNHPDLFSGEEDQFGYWKRSGKMIVVESLLKIWHKQGQRV
LLFSQSRQMLDILEVFLRAQKYTYLKMDGTTTIASRQPLITRYNEDTSIF
VFLLTTRVGGLGVNLTGANRVVIYDPDWNPSTDTQARERAWRIGQKKQVT
VYRLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKSNDLYELFTLT
SPDPLASSSLLAKMRARNHL
3D structure
PDB7oob Structural basis of human transcription-DNA repair coupling.
Chainb
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003682 chromatin binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0030296 protein tyrosine kinase activator activity
GO:0140658 ATP-dependent chromatin remodeler activity
Biological Process
GO:0000012 single strand break repair
GO:0000077 DNA damage checkpoint signaling
GO:0000303 response to superoxide
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006284 base-excision repair
GO:0006290 pyrimidine dimer repair
GO:0006338 chromatin remodeling
GO:0006362 transcription elongation by RNA polymerase I
GO:0006366 transcription by RNA polymerase II
GO:0006974 DNA damage response
GO:0006979 response to oxidative stress
GO:0007254 JNK cascade
GO:0007399 nervous system development
GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009411 response to UV
GO:0009636 response to toxic substance
GO:0010165 response to X-ray
GO:0010224 response to UV-B
GO:0010332 response to gamma radiation
GO:0022008 neurogenesis
GO:0030182 neuron differentiation
GO:0031175 neuron projection development
GO:0032784 regulation of DNA-templated transcription elongation
GO:0032786 positive regulation of DNA-templated transcription, elongation
GO:0034243 regulation of transcription elongation by RNA polymerase II
GO:0035264 multicellular organism growth
GO:0042262 DNA protection
GO:0045494 photoreceptor cell maintenance
GO:0045739 positive regulation of DNA repair
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0045945 positive regulation of transcription by RNA polymerase III
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
GO:0097680 double-strand break repair via classical nonhomologous end joining
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2001033 negative regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0008023 transcription elongation factor complex
GO:0090734 site of DNA damage
GO:0110016 B-WICH complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oob, PDBe:7oob, PDBj:7oob
PDBsum7oob
PubMed34526721
UniProtQ03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 (Gene Name=ERCC6)

[Back to BioLiP]