Structure of PDB 7oh3 Chain b

Receptor sequence

>7oh3b (length=455) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MQLSWKDIPTVAPANDLLDIVLNRTQRKTPTVIRPGFKITRIRAFYMRKV
KYTGEGFVEKFEDILKGFPNINDVHPFHRDLMDTLYEKNHYKISLAAISR
AKSLVEQVARDYVRLLKFGQSLFQCKQLKRAALGRMATIVKKLRDPLAYL
EQVRQHIGRLPSIDPNTRTLLICGYPNVGKSSFLRCITKSDVDVQPYAFT
TKSLYVGHFDYKYLRFQAIDTPGILDRPTEEMNNIEMQSIYAIAHLRSCV
LYFMDLSEQCGFTIEAQVKLFHSIKPLFANKSVMVVINKTDIIRPEDLDE
ERAQLLESVKEVPGVEIMTSSCQLEENVMEVRNKACEKLLASRIENKLKH
VAQPQARKRTPFIPESVKNLKKYDPEDPNRRKLARDIEAENGGAGVFNVN
LKDKYLLEDDEWKNDIMPEILDGKNVYDFLDPEIAAKLQALEEEEEKLEN
EGFYN

3D structure

PDB

7oh3 Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	K6 T10 D19 L22 N23 Q26 R27 K28 T29 P30 T31 R34 P35 F37 R43 M47 R48 K49 N70 Y91 K92 I93 L95 A96 S99 R100 R110 K117 F118 F123 K126 K129 R130 A131 L133 G134 R135 Q155 R159 S162 K189 Y197 F199 V206 H208 R227 N233 I235 R400 G410	K6 T10 D19 L22 N23 Q26 R27 K28 T29 P30 T31 R34 P35 F37 R43 M47 R48 K49 N70 Y91 K92 I93 L95 A96 S99 R100 R110 K117 F118 F123 K126 K129 R130 A131 L133 G134 R135 Q155 R159 S162 K189 Y197 F199 V206 H208 R227 N233 I235 R385 G395
BS02	MG	b	Q195 T200	Q195 T200

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis
GO:1902626	assembly of large subunit precursor of preribosome

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0030687	preribosome, large subunit precursor

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7oh3, PDBe:7oh3, PDBj:7oh3
PDBsum	7oh3
PubMed	34813592
UniProt	Q02892\|NOG1_YEAST Nucleolar GTP-binding protein 1 (Gene Name=NOG1)

[Back to BioLiP]