Structure of PDB 7ns4 Chain b

Receptor sequence

>7ns4b (length=340) Species: 559292 (Saccharomyces cerevisiae S288C)

SELLDSFETEFAKFYTDSNLEETNLQKCLDHTHEFKSQLKKLKAHLNKHI
QESKPKRKRELIIEKLSKSQRQWDHSVKKQIKYVSQQSNRFNKSTLNKLK
EFDIDSVYVNKLPKETMENVNEAIGYHILRYSIDNMPLGNKNEAFQYLKD
VYGITNKESTEFIEMGQIVHDLKKGDTESCLKWCSNEMSNHTALSSLKFD
LYTLSAVNKELKECTSLFIKEYCAAKHIFFDSPLFLIVLSGLISFQFFIK
YKTIREWTTKDELPFDVKLPDFLTHFHPIFICPVLKEETTTENPPYSLAC
HHIISKKALDRLSKNGTITFKCCPVNTSMSSTKKVRFVML

3D structure

• PDB: 7ns4 GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
• Chain: b
• Resolution: 3.9 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	b	H381 C401 C404	H302 C322 C323

Gene Ontology

Molecular Function

• GO:0004842 ubiquitin-protein transferase activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0061630 ubiquitin protein ligase activity

Biological Process

• GO:0006511 ubiquitin-dependent protein catabolic process
• GO:0016567 protein ubiquitination
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0045721 negative regulation of gluconeogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005777 peroxisome
• GO:0005829 cytosol
• GO:0034657 GID complex

External links

• PDB: RCSB:7ns4, PDBe:7ns4, PDBj:7ns4
• PDBsum: 7ns4
• PubMed: 33905682
• UniProt: Q12508|RMD5_YEAST E3 ubiquitin-protein ligase RMD5 (Gene Name=RMD5)