Structure of PDB 7asn Chain b

Receptor sequence
>7asnb (length=48) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
AVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSY
3D structure
PDB7asn Staphylococcus aureus 50S after 30 minutes incubation a 37C
Chainb
Resolution2.73 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b A2 V3 P4 K5 R6 R7 T8 S9 K10 T11 R12 K13 K15 R16 R17 T18 H19 T28 E29 P31 Y36 S39 H40 A1 V2 P3 K4 R5 R6 T7 S8 K9 T10 R11 K12 K14 R15 R16 T17 H18 T27 E28 P30 Y35 S38 H39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015934 large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7asn, PDBe:7asn, PDBj:7asn
PDBsum7asn
PubMed
UniProtQ2FZF1|RL32_STAA8 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]