Structure of PDB 7abg Chain b |
>7abgb (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] |
PLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDG ALSGHLGEVLIRCNNVLYIRGVE |
|
PDB | 7abg Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation. |
Chain | b |
Resolution | 7.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
b |
P7 W25 Y39 |
P4 W22 Y36 |
|
|
|
|