Structure of PDB 6yam Chain b

Receptor sequence

>6yamb (length=99) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCACCVPKDKAIKKFVIRNIVEAAAVR
DISEVSVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPR

3D structure

PDB

6yam Structural Insights into the Mammalian Late-Stage Initiation Complexes.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	T2 K3 K4 R5 R6 N7 N8 R10 A11 K12 K13 G14 R15 G16 H17 K32 K34 K37 F39 K70 V75 S76 I79 K82 V83 V84 N86 R87 S88 R89 R92 R95 P98 R100	T1 K2 K3 R4 R5 N6 N7 R9 A10 K11 K12 G13 R14 G15 H16 K31 K33 K36 F38 K69 V74 S75 I78 K81 V82 V83 N85 R86 S87 R88 R91 R94 P97 R99
BS02	rna	b	N25 I41 R42 H80 R100	N24 I40 R41 H79 R99

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6yam, PDBe:6yam, PDBj:6yam
PDBsum	6yam
PubMed
UniProt	G1TFE8\|RS26_RABIT Small ribosomal subunit protein eS26 (Gene Name=RPS26)