Structure of PDB 6y53 Chain b

Receptor sequence
>6y53b (length=166) Species: 9606 (Homo sapiens) [Search protein sequence]
IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQA
FVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGPNYILF
LNNLPEETNEMMLSMLFNQFPGFKEVRLDIAFVEFENDGQAGAARDALQG
FKITPSHAMKITYAKK
3D structure
PDB6y53 Molecular architecture of the human 17S U2 snRNP.
Chainb
Resolution7.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b N16 A45 K47 K50 R52 Y86 K88 N11 A40 K42 K45 R47 Y81 K83
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030619 U1 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y53, PDBe:6y53, PDBj:6y53
PDBsum6y53
PubMed32494006
UniProtP08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' (Gene Name=SNRPB2)

[Back to BioLiP]