Structure of PDB 6w2t Chain b

Receptor sequence

>6w2tb (length=101) Species: 9986 (Oryctolagus cuniculus)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEVSVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

• PDB: 6w2t A complex IRES at the 5'-UTR of a viral mRNA assembles a functional 48S complex via an uAUG intermediate.
• Chain: b
• Resolution: 3.36 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	T2 K3 K4 R5 R6 N7 N8 G9 R10 K13 G14 R15 H17 P20 K32 K34 K37 F39 V75 S76 I79 H80 V83 V84 R85 N86 R87 S88 R92 R95 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 G8 R9 K12 G13 R14 H16 P19 K31 K33 K36 F38 V74 S75 I78 H79 V82 V83 R84 N85 R86 S87 R91 R94 P96 P97 R99
BS02	rna	b	I41 E46 A47 R100 R102	I40 E45 A46 R99 R101
BS03	ZN	b	C23 C26 C77	C22 C25 C76

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005791 rough endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6w2t, PDBe:6w2t, PDBj:6w2t
• PDBsum: 6w2t
• PubMed: 32286223
• UniProt: G1TFE8|RS26_RABIT Small ribosomal subunit protein eS26 (Gene Name=RPS26)