Structure of PDB 6tnn Chain b

Receptor sequence
>6tnnb (length=123) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFK
VYKNTMTRRAVEQAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNH
EALEIKAGVIEGKVSTVEEVKAL
3D structure
PDB6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
Chainb
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b T7 K8 D29 Y30 R31 G32 L33 N34 E37 L41 R42 V50 V54 Y55 K56 N57 T58 M59 R61 E65 G78 P79 N80 T4 K5 D26 Y27 R28 G29 L30 N31 E34 L38 R39 V47 V51 Y52 K53 N54 T55 M56 R58 E62 G75 P76 N77
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
PDBsum6tnn
PubMed32991829
UniProtP42923|RL10_BACSU Large ribosomal subunit protein uL10 (Gene Name=rplJ)

[Back to BioLiP]