Structure of PDB 6ri5 Chain b

Receptor sequence

>6ri5b (length=219) Species: 4932 (Saccharomyces cerevisiae)

VAAERAARKAANKEKRAIILERNAAYQKEYETAERNIIQAKRDAKAAGSY
YVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKATLE
LLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLGK
YGILSIDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFIQ
GGSFGNREEFINKLVKSMN

3D structure

• PDB: 6ri5 Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
• Chain: b
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	R33 N37 R41 R60 R67 K70 K90 G91 I92 N93 K94 P97 K98 K101 L105 R110 I111 L126 S142 R145 K150 K158 Q159 R160 K196 N200 K206 L207 S208 N209 P210 G212 P217 R218 K219 K241	R8 N12 R16 R35 R42 K45 K65 G66 I67 N68 K69 P72 K73 K76 L80 R85 I86 L101 S117 R120 K125 K133 Q134 R135 K171 N175 K181 L182 S183 N184 P185 G187 P192 R193 K194 K216
BS02	rna	b	K128 E131 R218 F220 H222 Q225	K103 E106 R193 F195 H197 Q200

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ri5, PDBe:6ri5, PDBj:6ri5
• PDBsum: 6ri5
• PubMed: 31115337
• UniProt: P05737|RL7A_YEAST Large ribosomal subunit protein uL30A (Gene Name=RPL7A)