Structure of PDB 6r6g Chain b

Receptor sequence

>6r6gb (length=104) Species: 9986 (Oryctolagus cuniculus)

AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK
KGLKKMQANNAKAMAARAEAIKALVVSRKLHRLAYIAHPKLGRRARARIA
RGLR

3D structure

• PDB: 6r6g Structural and mutational analysis of the ribosome-arresting human XBP1u.
• Chain: b
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	A2 K3 S4 K5 N6 H7 T8 T9 H10 N11 Q12 S13 R14 K15 H17 R18 N19 K22 K23 S26 Q27 R28 Y29 K33 P37 K38 F39 R41 N42 R44 F45 A46 K47 H49 G53 M57 N60 N61 M65 H101 R106 A110 G115 R117	A1 K2 S3 K4 N5 H6 T7 T8 H9 N10 Q11 S12 R13 K14 H16 R17 N18 K21 K22 S25 Q26 R27 Y28 K32 P36 K37 F38 R40 N41 R43 F44 A45 K46 H48 G52 M56 N59 N60 M64 H88 R93 A97 G102 R104

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6r6g, PDBe:6r6g, PDBj:6r6g
• PDBsum: 6r6g
• PubMed: 31246176
• UniProt: G1SGR6|RL29_RABIT Large ribosomal subunit protein eL29 (Gene Name=RPL29)