Structure of PDB 6q95 Chain b

Receptor sequence
>6q95b (length=59) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
AKHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGY
YAGRKVLEV
3D structure
PDB6q95 How a circularized tmRNA moves through the ribosome.
Chainb
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b A2 K3 H4 P5 V6 P7 K8 K9 K10 T11 S12 K13 A14 R15 R16 D17 A18 R19 R20 S21 H22 T29 V31 P32 P34 P42 H43 Y51 A1 K2 H3 P4 V5 P6 K7 K8 K9 T10 S11 K12 A13 R14 R15 D16 A17 R18 R19 S20 H21 T28 V30 P31 P33 P41 H42 Y50
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6q95, PDBe:6q95, PDBj:6q95
PDBsum6q95
PubMed30765567
UniProtP80339|RL32_THET8 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]