Structure of PDB 6p4h Chain b

Receptor sequence

>6p4hb (length=98) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCACCVPKDKAIKKFVIRNIVEAAAVR
DISEVSVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPP

3D structure

PDB

6p4h The Israeli acute paralysis virus IRES captures host ribosomes by mimicking a ribosomal state with hybrid tRNAs.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	T2 K3 K4 R5 R6 N7 N8 G9 R10 K12 K13 G14 R15 G16 H17 Q19 K32 K34 K37 K38 F39 Y68 K70 V75 S76 I79 H80 K82 V84 R85 N86 R87 S88 R92 K93 R95 P97 P98	T1 K2 K3 R4 R5 N6 N7 G8 R9 K11 K12 G13 R14 G15 H16 Q18 K31 K33 K36 K37 F38 Y67 K69 V74 S75 I78 H79 K81 V83 R84 N85 R86 S87 R91 K92 R94 P96 P97

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6p4h, PDBe:6p4h, PDBj:6p4h
PDBsum	6p4h
PubMed	31609474
UniProt	G1TFE8\|RS26_RABIT Small ribosomal subunit protein eS26 (Gene Name=RPS26)