Structure of PDB 6n8k Chain b

Receptor sequence

>6n8kb (length=606) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MQLSWKDIPTVAPANDLLDIVLNRTQRKTPTVIRPGFKITRIRAFYMRKV
KYTGEGFVEKFEDILKGFPNINDVHPFHRDLMDTLYEKNHYKISLAAISR
AKSLVEQVARDYVRLLKFGQSLFQCKQLKRAALGRMATIVKKLRDPLAYL
EQVRQHIGRLPSIDPNTRTLLICGYPNVGKSSFLRCITKSDVDVQPYAFT
TKSLYVGHFDYKYLRFQAIDTPGILDRPTEEMNNIEMQSIYAIAHLRSCV
LYFMDLSEQCGFTIEAQVKLFHSIKPLFANKSVMVVINKTDIIRPEDLDE
ERAQLLESVKEVPGVEIMTSSCQLEENVMEVRNKACEKLLASRIENNNVL
NKIHVAQPQARDDVKRTPFIPESVKNLKKYDPEDPNRRKLARDIEAENGG
AGVFNVNLKDKYLLEDDEWKNDIMPEILDGKNVYDFLDPEIAAKLQALEE
EEEKLENEGFYNSDDEEEIYDGFEASEVDDIKEKAAWIRNRQKTMIAEAR
NRKSLKNKAIMPRSKLTKSFGKMEEHMSTLGHDMSALQDKQNRQTDRLLD
GVADGSMRSKADRMAKMERRERNRHAKQGESDRHNAVSLSKHLFSGKRGV
GKTDFR

3D structure

PDB

6n8k Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	b	D19 L22 Q26 R27 K28 T31 V32 I33 R34 P35 G36 K38 I39 T40 R41 K49 L65 N70 N89 Y91 K92 I93 L95 A96 R110 R114 K117 F123 K126 K129 G134 R135 T138 E151 R154 Q155 R159 S162 S190 D191 Y197 F199 Y205 V206 H208 N233 I504 R508 R510 S512 L513 K514 N515 I518 R521 Q585 T586 R588 L589 K601 M608 R610 R611 N614 K618 Q619 R624 H625 N626 H633 K638 R639 V641 G642 K643 T644 F646 R647	D19 L22 Q26 R27 K28 T31 V32 I33 R34 P35 G36 K38 I39 T40 R41 K49 L65 N70 N89 Y91 K92 I93 L95 A96 R110 R114 K117 F123 K126 K129 G134 R135 T138 E151 R154 Q155 R159 S162 S190 D191 Y197 F199 Y205 V206 H208 N233 I496 R500 R502 S504 L505 K506 N507 I510 R513 Q544 T545 R547 L548 K560 M567 R569 R570 N573 K577 Q578 R583 H584 N585 H592 K597 R598 V600 G601 K602 T603 F605 R606
BS02	rna	b	D591 G592	D550 G551
BS03	GTP	b	N177 V178 G179 K180 S181 S182 T201 D220 K289 S321 C322	N177 V178 G179 K180 S181 S182 T201 D220 K289 S321 C322
BS04	MG	b	Q195 Y197 T200	Q195 Y197 T200

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis
GO:1902626	assembly of large subunit precursor of preribosome

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0030687	preribosome, large subunit precursor

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6n8k, PDBe:6n8k, PDBj:6n8k
PDBsum	6n8k
PubMed	30814529
UniProt	Q02892\|NOG1_YEAST Nucleolar GTP-binding protein 1 (Gene Name=NOG1)

[Back to BioLiP]