Structure of PDB 6g90 Chain b

Receptor sequence

>6g90b (length=121) Species: 4932 (Saccharomyces cerevisiae)

SKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEE
RVPKTQLDKLRPLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLV
RDKKEKKQAQKQTKLRKEKEK

3D structure

• PDB: 6g90 Prespliceosome structure provides insights into spliceosome assembly and regulation.
• Chain: b
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	K3 Q5 A7 H8 H40 N42 T56 K60 V81 E90 S104 K105 K106 Q118 K121 R126	K2 Q4 A6 H7 H39 N41 T55 K59 V71 E80 S94 K95 K96 Q108 K111 R116

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0070990 snRNP binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000387 spliceosomal snRNP assembly
• GO:0000395 mRNA 5'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0036261 7-methylguanosine cap hypermethylation
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005682 U5 snRNP
• GO:0005685 U1 snRNP
• GO:0005686 U2 snRNP
• GO:0005687 U4 snRNP
• GO:0005737 cytoplasm
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071001 U4/U6 snRNP
• GO:0071004 U2-type prespliceosome
• GO:0071013 catalytic step 2 spliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6g90, PDBe:6g90, PDBj:6g90
• PDBsum: 6g90
• PubMed: 29995849
• UniProt: P40018|RSMB_YEAST Small nuclear ribonucleoprotein-associated protein B (Gene Name=SMB1)