Structure of PDB 6g5h Chain b

Receptor sequence
>6g5hb (length=82) Species: 9606 (Homo sapiens) [Search protein sequence]
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQ
TVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQ
3D structure
PDB6g5h Visualizing late states of human 40S ribosomal subunit maturation.
Chainb
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b R17 H19 K20 K21 K22 Q26 P28 N29 S30 F47 Q51 G69 K70 R16 H18 K19 K20 K21 Q25 P27 N28 S29 F46 Q50 G68 K69
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6g5h, PDBe:6g5h, PDBj:6g5h
PDBsum6g5h
PubMed29875412
UniProtP42677|RS27_HUMAN Small ribosomal subunit protein eS27 (Gene Name=RPS27)

[Back to BioLiP]