Structure of PDB 6fyy Chain b

Receptor sequence
>6fyyb (length=81) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]
VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQ
TAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
3D structure
PDB6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
Chainb
Resolution3.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b R17 H19 K20 L21 K22 Q26 P28 S30 F32 F47 H49 Q51 P66 T67 G68 G69 K70 R16 H18 K19 L20 K21 Q25 P27 S29 F31 F46 H48 Q50 P65 T66 G67 G68 K69
BS02 ZN b C59 T61 C58 T60
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
PDBsum6fyy
PubMed30475211
UniProtQ6CNL2

[Back to BioLiP]