Structure of PDB 6ft6 Chain b

Receptor sequence

>6ft6b (length=642) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MQLSWKDIPTVAPANDLLDIVLNRTQRKTPTVIRPGFKITRIRAFYMRKV
KYTGEGFVEKFEDILKGFPNINDVHPFHRDLMDTLYEKNHYKISLAAISR
AKSLVEQVARDYVRLLKFGQSLFQCKQLKRAALGRMATIVKKLRDPLAYL
EQVRQHIGRLPSIDPNTRTLLICGYPNVGKSSFLRCITKSDVDVQPYAFT
TKSLYVGHFDYKYLRFQAIDTPGILDRPTEEMNNIEMQSIYAIAHLRSCV
LYFMDLSEQCGFTIEAQVKLFHSIKPLFANKSVMVVINKTDIIRPEDLDE
ERAQLLESVKEVPGVEIMTSSCQLEENVMEVRNKACEKLLASRIENKLKS
QSRINNVLNKIHVAQPQARDDVKRTPFIPESVKNLKKYDPEDPNRRKLAR
DIEAENGGAGVFNVNLKDKYLLEDDEWKNDIMPEILDGKNVYDFLDPEIA
AKLQALEEEEEKLENEGFYNEIYDGFEASEVDDIKEKAAWIRNRQKTMIA
EARNRKSLKNKAIMPRSKLTKSFGKMEEHMSTLGHDMSALQDKQNRAARK
NRYVERGSDVVFGDQDALTASTENGVKLRQTDRLLDGVADGSMRSKADRM
AKMERRERNRHAKQGESDRHNAVSLSKHLFSGKRGVGKTDFR

3D structure

PDB

6ft6 Structure of the nuclear exosome captured on a maturing preribosome.

Chain

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	b	K6 D19 L22 N23 Q26 R27 K28 T31 R34 F37 R43 Y46 R48 K49 N70 N89 K92 I93 L95 A96 S99 R100 R110 R114 K117 F118 F123 K126 K129 R130 A131 L133 G134 R135 T138 R154 Q155 R159 S162 K189 D191 Y197 F199 H208 N233 A409 G410 Q500 I504 R508 R510 K514 N515 K516 R521 R561 N579 Q585 T586 D587 R588 L589 K601 M608 R610 R611 N614 R624 H625 H633 R639 V641 G642 K643 T644 D645 F646 R647	K6 D19 L22 N23 Q26 R27 K28 T31 R34 F37 R43 Y46 R48 K49 N70 N89 K92 I93 L95 A96 S99 R100 R110 R114 K117 F118 F123 K126 K129 R130 A131 L133 G134 R135 T138 R154 Q155 R159 S162 K189 D191 Y197 F199 H208 N233 A409 G410 Q495 I499 R503 R505 K509 N510 K511 R516 R556 N574 Q580 T581 D582 R583 L584 K596 M603 R605 R606 N609 R619 H620 H628 R634 V636 G637 K638 T639 D640 F641 R642
BS02	GTP	b	P176 N177 V178 G179 K180 S181 S182 V194 T201 K289 D291 S321 C322 Q323	P176 N177 V178 G179 K180 S181 S182 V194 T201 K289 D291 S321 C322 Q323
BS03	MG	b	A198 F199 T200	A198 F199 T200

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis
GO:1902626	assembly of large subunit precursor of preribosome

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0030687	preribosome, large subunit precursor

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ft6, PDBe:6ft6, PDBj:6ft6
PDBsum	6ft6
PubMed	29519915
UniProt	Q02892\|NOG1_YEAST Nucleolar GTP-binding protein 1 (Gene Name=NOG1)

[Back to BioLiP]