Structure of PDB 6exn Chain b

Receptor sequence

>6exnb (length=80) Species: 559292 (Saccharomyces cerevisiae S288C)

IQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERV
PKIKVEKRVLGLTILRGEQILSTVVEDKPL

3D structure

• PDB: 6exn Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
• Chain: b
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	S10 R11 H40 N42 R88 G89 E90	S7 R8 H37 N39 R66 G67 E68

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0070990 snRNP binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000387 spliceosomal snRNP assembly
• GO:0000395 mRNA 5'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0036261 7-methylguanosine cap hypermethylation
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005682 U5 snRNP
• GO:0005685 U1 snRNP
• GO:0005686 U2 snRNP
• GO:0005687 U4 snRNP
• GO:0005737 cytoplasm
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071001 U4/U6 snRNP
• GO:0071004 U2-type prespliceosome
• GO:0071013 catalytic step 2 spliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6exn, PDBe:6exn, PDBj:6exn
• PDBsum: 6exn
• PubMed: 29146871
• UniProt: P40018|RSMB_YEAST Small nuclear ribonucleoprotein-associated protein B (Gene Name=SMB1)