Structure of PDB 6c0f Chain b

Receptor sequence
>6c0fb (length=242) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
QRTLLISSRGVNYRHRHLIQDLSGLLPHSRKEPKLDTKKDLQQLNEIAEL
YNCNNVLFFEARKHQDLYLWLSKPPNGPTIKFYIQNLHTMDEAAAAAAAA
AGSRPVLSFDQRFESSPHYQLIKELLVHNFGVPPAAAAAAAAADHVMSFS
IVDDKIWVRTYESLVEIGPRFVMTVILILEGSFGGPKIYENKQYVSPNVV
RAQIKQQAAEEAKSRAEAAVERKIKRRENVLAADPLSNDALF
3D structure
PDB6c0f Modular assembly of the nucleolar pre-60S ribosomal subunit.
Chainb
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b R39 V41 Y43 R44 P63 K64 K69 Q72 R92 K93 H94 L227 G232 G233 P234 K235 N246 K253 R263 R270 K273 R9 V11 Y13 R14 P33 K34 K39 Q42 R62 K63 H64 L179 G184 G185 P186 K187 N198 K205 R215 R222 K225
BS02 peptide b R32 N82 N84 P105 E228 P234 R2 N52 N54 P75 E180 P186
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000464 endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c0f, PDBe:6c0f, PDBj:6c0f
PDBsum6c0f
PubMed29512650
UniProtQ08235|BRX1_YEAST Ribosome biogenesis protein BRX1 (Gene Name=BRX1)

[Back to BioLiP]