Structure of PDB 5umd Chain b

Receptor sequence
>5umdb (length=95) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]
GRKSTIKPATGIAVGFNSGHVVTKRNSKRKELIKDVVREITGFSPYEKRI
IELIKIGTSASTKRSLKYAKKKLGTHKRGKAKREEIQKVVILQRR
3D structure
PDB5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.
Chainb
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna b G2 R3 K4 T6 K8 G20 H21 S38 R40 K45 Y57 R60 E63 K74 R75 K78 K81 K82 K83 L84 G85 T86 H87 R89 K91 E96 G1 R2 K3 T5 K7 G19 H20 S27 R29 K34 Y46 R49 E52 K63 R64 K67 K70 K71 K72 L73 G74 T75 H76 R78 K80 E85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5umd, PDBe:5umd, PDBj:5umd
PDBsum5umd
PubMed28288098
UniProtQ8I713

[Back to BioLiP]