Structure of PDB 5mrc Chain b

Receptor sequence

>5mrcb (length=155) Species: 4932 (Saccharomyces cerevisiae)

YKQYFDSLPLKLKSFFQRYPPSIKYSPVSTSTKAINANPFLPNKHPVTQR
FHDPKYSLRRMSDVYKLALRYGVEEFLPPIENTKKLFFEEKYNKKTLMKG
VLLPKGHKHELKLNEKLKKREEALKKVDELIASKKGSKYAKRVEKMKKNQ
SIGWF

3D structure

• PDB: 5mrc The structure of the yeast mitochondrial ribosome.
• Chain: b
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	K13 R20 P44 H47 V49 T50 F53 H54 D55 K57 S59 L60 R61 S64 D65 K68 K87 K93 Y94 K97 M100 K101 G102 K107 G108 H109 K110 H111 K118 K137 S139 K140 R144 N151 Q152 S153 I154 G155 W156 F157	K11 R18 P42 H45 V47 T48 F51 H52 D53 K55 S57 L58 R59 S62 D63 K66 K85 K91 Y92 K95 M98 K99 G100 K105 G106 H107 K108 H109 K116 K135 S137 K138 R142 N149 Q150 S151 I152 G153 W154 F155

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5mrc, PDBe:5mrc, PDBj:5mrc
• PDBsum: 5mrc
• PubMed: 28154081
• UniProt: P23369|RM25_YEAST Large ribosomal subunit protein mL59 (Gene Name=MRPL25)