Structure of PDB 5l8b Chain b |
>5l8bb (length=88) Species: 1085 (Rhodospirillum rubrum) [Search protein sequence] |
THEPLEVLKEETVNRHRAIVSVMEELEAVDWYDQRVDASTDPELTAILAH NRDEAKEHAAMTLEWLRRNDAKWAEHLRTYLFTEGPIT |
|
PDB | 5l8b Structural characterization of encapsulated ferritin provides insight into iron storage in bacterial nanocompartments. |
Chain | b |
Resolution | 2.21 Å |
3D structure |
|
|
Enzyme Commision number |
1.16.3.1: ferroxidase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
b |
E31 E34 |
E24 E27 |
|
|
|
|