Structure of PDB 5imq Chain b

Receptor sequence

>5imqb (length=206) Species: 300852 (Thermus thermophilus HB8)

MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLG
FLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGE
RVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRV
YKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRE
TKKAAK

3D structure

• PDB: 5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
• Chain: b
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	G10 T12 R19 V21 R36 E40 K41 P56 K57 V59 N60 R61 K64 G65 I77 R79 K109 G110 R111 G112 F113 G115 W120 S128 H129 H132 I134 R136 P138 G139 S140 I141 G142 N143 R144 K145 T146 G148 R149 V150 K152 M156 A157 H159 R164 T166 M168 N169 K185 G190 P191 N192 K203 A204 A205 K206	G10 T12 R19 V21 R36 E40 K41 P56 K57 V59 N60 R61 K64 G65 I77 R79 K109 G110 R111 G112 F113 G115 W120 S128 H129 H132 I134 R136 P138 G139 S140 I141 G142 N143 R144 K145 T146 G148 R149 V150 K152 M156 A157 H159 R164 T166 M168 N169 K185 G190 P191 N192 K203 A204 A205 K206

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5imq, PDBe:5imq, PDBj:5imq
• PDBsum: 5imq
• PubMed: 27137929
• UniProt: Q5SHN8|RL3_THET8 Large ribosomal subunit protein uL3 (Gene Name=rplC)