Structure of PDB 5gpn Chain b

Receptor sequence
>5gpnb (length=149) Species: 9823 (Sus scrofa) [Search protein sequence]
TELVRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERC
IACKLCEAVCPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACP
VDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR
3D structure
PDB5gpn The architecture of the mammalian respirasome.
Chainb
Resolution5.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 b C113 I114 A115 C116 K117 C119 C162 P163 A166 I167 C50 I51 A52 C53 K54 C56 C99 P100 A103 I104
BS02 SF4 b H101 C123 C152 I153 Y154 C155 G156 F157 C158 H38 C60 C89 I90 Y91 C92 G93 F94 C95
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Feb 18 14:08:14 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5gpn', asym_id = 'b', title = 'The architecture of the mammalian respirasome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5gpn', asym_id='b', title='The architecture of the mammalian respirasome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016020,0016651,0051539', uniprot = '', pdbid = '5gpn', asym_id = 'b'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0016651,0051539', uniprot='', pdbid='5gpn', asym_id='b')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>