Structure of PDB 4v91 Chain b

Receptor sequence

>4v91b (length=58) Species: 28985 (Kluyveromyces lactis)

AKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTA
KALAAAKK

3D structure

• PDB: 4v91 Initiation of Translation by Cricket Paralysis Virus Ires Requires its Translocation in the Ribosome.
• Chain: b
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	K3 K5 N6 H7 T8 A9 H10 N11 Q12 T13 R14 K15 H17 R18 N19 K23 K25 T26 Y27 K28 Y29 P30 L32 K33 D36 P37 K38 F39 R40 R41 N42 H43 H45 A46 L47 G49	K2 K4 N5 H6 T7 A8 H9 N10 Q11 T12 R13 K14 H16 R17 N18 K22 K24 T25 Y26 K27 Y28 P29 L31 K32 D35 P36 K37 F38 R39 R40 N41 H42 H44 A45 L46 G48

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 23:48:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v91', asym_id = 'b', title = 'Initiation of Translation by Cricket Paralysis V... Ires Requires its Translocation in the Ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v91', asym_id='b', title='Initiation of Translation by Cricket Paralysis V... Ires Requires its Translocation in the Ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v91', asym_id = 'b'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v91', asym_id='b')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>