Structure of PDB 4d5l Chain b

Receptor sequence
>4d5lb (length=80) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
AKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTV
VLCVGCSTVLCQPTGGKARLTEGCSFRRKQ
3D structure
PDB4d5l Cryo-Em of Ribosomal 80S Complexes with Termination Factors Reveals the Translocated Cricket Paralysis Virus Ires.
Chainb
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna b R17 H19 K20 K21 Q26 P28 S30 F47 H49 Q51 P66 G68 G69 K70 E75 R14 H16 K17 K18 Q23 P25 S27 F44 H46 Q48 P63 G65 G66 K67 E72
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4d5l, PDBe:4d5l, PDBj:4d5l
PDBsum4d5l
PubMed25601755
UniProtG1TZ76|RS27_RABIT Small ribosomal subunit protein eS27 (Gene Name=RPS27)

[Back to BioLiP]