Structure of PDB 3jct Chain b

Receptor sequence

>3jctb (length=642) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MQLSWKDIPTVAPANDLLDIVLNRTQRKTPTVIRPGFKITRIRAFYMRKV
KYTGEGFVEKFEDILKGFPNINDVHPFHRDLMDTLYEKNHYKISLAAISR
AKSLVEQVARDYVRLLKFGQSLFQCKQLKRAALGRMATIVKKLRDPLAYL
EQVRQHIGRLPSIDPNTRTLLICGYPNVGKSSFLRCITKSDVDVQPYAFT
TKSLYVGHFDYKYLRFQAIDTPGILDRPTEEMNNIEMQSIYAIAHLRSCV
LYFMDLSEQCGFTIEAQVKLFHSIKPLFANKSVMVVINKTDIIRPEDLDE
ERAQLLESVKEVPGVEIMTSSCQLEENVMEVRNKACEKLLASRIENKLKS
QSRINNVLNKIHVAQPQARDDVKRTPFIPESVKNLKKYDPEDPNRRKLAR
DIEAENGGAGVFNVNLKDKYLLEDDEWKNDIMPEILDGKNVYDFLDPEIA
AKLQALEEEEEKLENEGFYNEIYDGFEASEVDDIKEKAAWIRNRQKTMIA
EARNRKSLKNKAIMPRSKLTKSFGKMEEHMSTLGHDMSALQDKQNRAARK
NRYVERGSDVVFGDQDALTASTENGVKLRQTDRLLDGVADGSMRSKADRM
AKMERRERNRHAKQGESDRHNAVSLSKHLFSGKRGVGKTDFR

3D structure

PDB

3jct Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes

Chain

Resolution

3.08 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	b	T10 D19 L22 N23 Q26 R27 K28 T31 V32 I33 R34 P35 G36 F37 K38 R41 R43 Y46 M47 R48 K49 N70 N89 K92 I93 L95 A96 S99 S103 R114 K117 F123 K126 K129 R130 G134 R135 T138 R154 Q155 R159 S162 K189 Y197 F199 H208 R227 N233 I235 G410 Q500 I504 R508 K514 N515 K516 I518 P520 R521 N579 G580 Q585 T586 R588 K601 M605 R610 R611 N614 A617 K618 Q619 R624 H633 R639 V641 G642 K643 T644 D645 F646 R647	T10 D19 L22 N23 Q26 R27 K28 T31 V32 I33 R34 P35 G36 F37 K38 R41 R43 Y46 M47 R48 K49 N70 N89 K92 I93 L95 A96 S99 S103 R114 K117 F123 K126 K129 R130 G134 R135 T138 R154 Q155 R159 S162 K189 Y197 F199 H208 R227 N233 I235 G410 Q495 I499 R503 K509 N510 K511 I513 P515 R516 N574 G575 Q580 T581 R583 K596 M600 R605 R606 N609 A612 K613 Q614 R619 H628 R634 V636 G637 K638 T639 D640 F641 R642
BS02	rna	b	R588 D591 G592	R583 D586 G587
BS03	GTP	b	N177 G179 K180 S181 S182 V194 T201 D220 K289 S321 C322	N177 G179 K180 S181 S182 V194 T201 D220 K289 S321 C322

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis
GO:1902626	assembly of large subunit precursor of preribosome

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0030687	preribosome, large subunit precursor

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jct, PDBe:3jct, PDBj:3jct
PDBsum	3jct
PubMed	27251291
UniProt	Q02892\|NOG1_YEAST Nucleolar GTP-binding protein 1 (Gene Name=NOG1)

[Back to BioLiP]